The store will not work correctly when cookies are disabled.
Protein or Target Summary
YTH domain-containing family protein 2
| Gene ID | 51441 |
|---|
| uniprot | Q9Y5A9 |
|---|
| Gene Name | YTHDF2 |
|---|
| Ensernbl ID | ENSP00000362918 |
|---|
| Family | Belongs to the YTHDF2 family. |
|---|
| Sequence | MSASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 51441 | YTHDF2 | YTH domain-containing family protein 2 | Q9Y5A9 |
| MOUSE | | Ythdf2 | YTH domain-containing family protein 2 | E9PW90 |
| MOUSE | | Ythdf2 | Uncharacterized protein | Q3UNH5 |
| MOUSE | | Ythdf2 | Uncharacterized protein | Q8BUI8 |
| MOUSE | | Ythdf2 | YTH domain-containing family protein 2 | F6Y6H7 |
| MOUSE | 213541 | Ythdf2 | YTH domain-containing family protein 2 | Q91YT7 |
| RAT | | Ythdf2 | YTH N(6)-methyladenosine RNA-binding protein 2 | E9PU11 |
| RAT | 313053 | Ythdf2 | ZH3 protein | Q1JU70 |
| RAT | | Ythdf2 | YTH domain family 2 (Predicted) | B2GUU1 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
