Protein or Target Summary
Platelet glycoprotein VI
Gene ID | 51206 |
---|---|
uniprot | Q9HCN6 |
Gene Name | GP6 |
Ensernbl ID | ENSP00000308782 |
Sequence | MSPSPTALFCLGLCLGRVPAQSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTKGNLVRICLGAVILIILAGFLAEDWHSRRKRLRHRGRAVQRPLPPLPPLPLTRKSNGGQDGGRQDVHSRGLCS Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / receptor / immunoglobulin receptor superfamily / Platelet glycoprotein VI
protein / receptor / defense/immunity protein / Platelet glycoprotein VI
protein / receptor / protease inhibitor / Platelet glycoprotein VI
protein / receptor / cytokine receptor / Platelet glycoprotein VI
protein / receptor / immunoglobulin receptor superfamily / Platelet glycoprotein VI
protein / receptor / defense/immunity protein / Platelet glycoprotein VI
protein / receptor / protease inhibitor / Platelet glycoprotein VI
protein / receptor / cytokine receptor / Platelet glycoprotein VI
DTO Classes
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / Platelet glycoprotein VI
protein / Receptor / Cytokine receptor / Immunoglobulin receptor superfamily / Platelet glycoprotein VI
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx