The store will not work correctly when cookies are disabled.
Protein or Target Summary
Putative peripheral benzodiazepine receptor-related protein
| Gene ID | 706 |
|---|
| uniprot | B1AH88 |
|---|
| Gene Name | TSPO |
|---|
| Ensernbl ID | ENSP00000379563 |
|---|
| Sequence | MAPHLLWCPTNGLGLGGSPAGQWGGGSHYRGLVPGEPAGRPPALPLPGLAGLHDHTQLLRMAGQPWLAWGTAAARVSARPTRDCSCTSRCHHACDVVAVTLS Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 706 | TSPO | Putative peripheral benzodiazepine receptor-related protein | B1AH88 |
| MOUSE | | Tspo | Translocator protein | A0A140LIU9 |
| MOUSE | 12257 | Tspo | Translocator protein | P50637 |
| RAT | 24230 | Tspo | Translocator protein | P16257 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
