The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tumor necrosis factor receptor superfamily member 3
| Gene ID | 4055 |
|---|
| uniprot | P36941 |
|---|
| Gene Name | LTBR |
|---|
| Ensernbl ID | ENSP00000228918 |
|---|
| Sequence | MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLLATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGDVSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGNIYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGATPSNRGPRNQFITHD Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 4055 | LTBR | Tumor necrosis factor receptor superfamily member 3 | P36941 |
| MOUSE | | Ltbr | Uncharacterized protein | Q8BJV0 |
| MOUSE | | Ltbr | Uncharacterized protein | Q3UK82 |
| MOUSE | 17000 | Ltbr | Lymphotoxin B receptor | B2RRV3 |
| MOUSE | 17000 | Ltbr | Tumor necrosis factor receptor superfamily member 3 | P50284 |
| RAT | 297604 | Ltbr | Lymphotoxin B receptor | Q5U2S8 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
