The store will not work correctly when cookies are disabled.
TIMM50
| Description | Mitochondrial import inner membrane translocase subunit TIM50 |
|---|
Gene and Protein Information
| Gene ID | 92609 |
|---|
| Uniprot Accession IDs | Q330K1 Q6QA00 Q96FJ5 Q96GY2 Q9H370 |
|---|
| Ensembl ID | ENSP00000445806 |
|---|
| Symbol | TIM50 MGCA9 TIM50 TIM50L |
|---|
| Family | Belongs to the TIM50 family. |
|---|
| Sequence | MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWLAGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQEPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLSAFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRSKQP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 456026 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9598 | VGNC:8335 | OMA, EggNOG |
| Macaque | 697583 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9544 | | OMA, EggNOG |
| Mouse | 66525 | Timm50 | translocase of inner mitochondrial membrane 50 | 10090 | MGI:1913775 | Inparanoid, OMA, EggNOG |
| Rat | 687295 | Timm50 | translocase of inner mitochondrial membrane 50 | 10116 | RGD:1587684 | OMA, EggNOG |
| Dog | 476461 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9615 | VGNC:49032 | Inparanoid, OMA, EggNOG |
| Horse | 100067604 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9796 | VGNC:50508 | Inparanoid, OMA, EggNOG |
| Cow | 505489 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9913 | VGNC:49147 | Inparanoid, OMA, EggNOG |
| Pig | 100623818 | TIMM50 | translocase of inner mitochondrial membrane 50 | 9823 | | OMA, EggNOG |
| Opossum | 100014514 | TIMM50 | translocase of inner mitochondrial membrane 50 | 13616 | | Inparanoid, OMA, EggNOG |
| Anole lizard | 100568074 | timm50 | translocase of inner mitochondrial membrane 50 | 28377 | | Inparanoid, EggNOG |
| Xenopus | 100145004 | timm50 | translocase of inner mitochondrial membrane 50 homolog | 8364 | XB-GENE-963112 | Inparanoid, OMA, EggNOG |
| Zebrafish | 393638 | timm50 | translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae) | 7955 | ZDB-GENE-040426-1618 | Inparanoid, OMA, EggNOG |
| C. elegans | 179481 | scpl-4 | Mitochondrial import inner membrane translocase subunit TIM50 | 6239 | | Inparanoid, EggNOG |
| S.cerevisiae | 856042 | TIM50 | protein translocase subunit TIM50 | 4932 | S000005984 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
