The store will not work correctly when cookies are disabled.
Protein or Target Summary
Transmembrane protease serine 2
Gene ID | 7113 |
uniprot | O15393 |
Gene Name | TMPRSS2 |
Ensernbl ID | ENSP00000381588 |
Family | Belongs to the peptidase S1 family. |
Sequence | MALNSGSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 7113 | TMPRSS2 | Transmembrane protease serine 2 | O15393 |
MOUSE | | Tmprss2 | Uncharacterized protein | Q3TTU9 |
MOUSE | | Tmprss2 | Transmembrane protease serine 2 | A0A338P779 |
MOUSE | | Tmprss2 | Uncharacterized protein | Q3UKE3 |
MOUSE | | Tmprss2 | Transmembrane protease serine 2 | A0A338P6L7 |
MOUSE | 50528 | Tmprss2 | Transmembrane protease serine 2 | Q9JIQ8 |
RAT | | TMPRSS2 | TMPRSS2 | Q920K3 |
RAT | | Tmprss2 | Transmembrane serine protease 2 | F1M6J6 |
RAT | 156435 | Tmprss2 | Transmembrane protease, serine 2 | Q6P7D7 |
Protein Classes
PANTHER Classes protein /
serine protease / Transmembrane protease serine 2
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|