JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Mitochondrial mRNA pseudouridine synthase TRUB2

Gene ID	26995
uniprot	O95900
Gene Name	TRUB2
Ensernbl ID	ENSP00000361982
Family	Belongs to the pseudouridine synthase TruB family.
Sequence	MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	26995	TRUB2	Mitochondrial mRNA pseudouridine synthase TRUB2	O95900
MOUSE	227682	Trub2	Mitochondrial mRNA pseudouridine synthase Trub2	H3BKT7
MOUSE		Trub2	Mitochondrial mRNA pseudouridine synthase Trub2	H3BLS1
MOUSE		Trub2	Mitochondrial mRNA pseudouridine synthase Trub2	A2ARC1
MOUSE	227682	Trub2	Mitochondrial mRNA pseudouridine synthase Trub2	Q91WG3
RAT	366012	Trub2	Mitochondrial mRNA pseudouridine synthase Trub2	Q5XFW2

Protein Classes

PANTHER Classes
protein / lyase / Mitochondrial mRNA pseudouridine synthase TRUB2

DTO Classes
protein / Enzyme / Lyase / Mitochondrial mRNA pseudouridine synthase TRUB2

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx