JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tumor necrosis factor receptor superfamily member 14

Gene ID	8764
uniprot	Q92956
Gene Name	TNFRSF14
Ensernbl ID	ENSP00000347948
Sequence	MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	8764	TNFRSF14	Tumor necrosis factor receptor superfamily member 14	Q92956
MOUSE	230979	Tnfrsf14	Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)	A0A1W2P7D5
MOUSE		Tnfrsf14	Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)	A0A1W2P889
MOUSE		Tnfrsf14	Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)	A0A1W2P6M8
MOUSE		Tnfrsf14	Tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator)	F6Y2U8
MOUSE		Tnfrsf14	Tnfrsf14 protein	Q8VC17
MOUSE		Tnfrsf14	Tumor necrosis factor receptor superfamily, member 14 (Herpesvirus entry mediator)	Q3SXX1
MOUSE	230979	Tnfrsf14	Tumor necrosis factor receptor superfamily member 14	Q80WM9
MOUSE		Tnfrsf14	Herpes virus entry mediator	Q71F55
RAT	366518	Tnfrsf14	TNF receptor superfamily member 14	Q5BK53

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx