The store will not work correctly when cookies are disabled.
TPMT
| Description | Thiopurine S-methyltransferase |
|---|
Gene and Protein Information
| Gene ID | 7172 |
|---|
| Uniprot Accession IDs | O14806 O15423 O15424 O15425 O15426 O15515 O15548 O43213 Q5VUK6 Q9UBE6 Q9UBT8 Q9UE62 |
|---|
| Ensembl ID | ENSP00000312304 |
|---|
| Symbol | TPMTD |
|---|
| Family | Belongs to the class I-like SAM-binding methyltransferase superfamily. TPMT family. |
|---|
| Sequence | MDGTRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTEK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 471863 | TPMT | thiopurine S-methyltransferase | 9598 | VGNC:7936 | Inparanoid, OMA, EggNOG |
| Macaque | 704564 | TPMT | thiopurine S-methyltransferase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 22017 | Tpmt | thiopurine methyltransferase | 10090 | MGI:98812 | Inparanoid, OMA, EggNOG |
| Dog | 403536 | TPMT | thiopurine S-methyltransferase | 9615 | VGNC:47745 | Inparanoid, OMA, EggNOG |
| Horse | 100034066 | TPMT | thiopurine S-methyltransferase | 9796 | VGNC:24436 | Inparanoid, OMA, EggNOG |
| Cow | 511644 | TPMT | thiopurine S-methyltransferase | 9913 | VGNC:36255 | Inparanoid, OMA, EggNOG |
| Pig | 100157630 | TPMT | thiopurine S-methyltransferase | 9823 | | Inparanoid, OMA, EggNOG |
| Opossum | 100025242 | TPMT | thiopurine S-methyltransferase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | TPMT | thiopurine S-methyltransferase [Source:HGNC Symbol;Acc:HGNC:12014] | 9258 | | OMA, EggNOG |
| Chicken | 420830 | TPMT | thiopurine S-methyltransferase | 9031 | CGNC:9625 | Inparanoid, OMA, EggNOG |
| Xenopus | 549164 | tpmt | thiopurine S-methyltransferase | 8364 | XB-GENE-941707 | Inparanoid, OMA, EggNOG |
| Zebrafish | 573111 | tpmt.2 | thiopurine S-methyltransferase, tandem duplicate 2 | 7955 | ZDB-GENE-041010-177 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
