JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Tumor necrosis factor receptor superfamily member 12A

Gene ID	51330
uniprot	Q9NP84
Gene Name	TNFRSF12A
Ensernbl ID	ENSP00000326737
Sequence	MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	51330	TNFRSF12A	Tumor necrosis factor receptor superfamily member 12A	Q9NP84
MOUSE	27279	Tnfrsf12a	Tumor necrosis factor receptor superfamily member 12A	E9PZT5
MOUSE		Tnfrsf12a	Tumor necrosis factor receptor superfamily member 12A	A0A3B2W475
MOUSE		Tnfrsf12a	Tumor necrosis factor receptor superfamily member 12A	A0A3B2W7Y2
MOUSE	27279	Tnfrsf12a	Tumor necrosis factor receptor superfamily member 12A	Q9CR75
RAT		Tnfrsf12a	TNF receptor superfamily member 12A	G3V6F9
RAT	302965	Tnfrsf12a	Tumor necrosis factor receptor superfamily, member 12a	Q80XX9

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx