JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
TNFRSF12A

TNFRSF12A

Description	Tumor necrosis factor receptor superfamily member 12A

Gene and Protein Information

Gene ID	51330
Uniprot Accession IDs	D3DUA6 Q9HCS0
Ensembl ID	ENSP00000326737
Symbol	FN14 FN14 CD266 TWEAKR
Sequence	MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	107968771	TNFRSF12A	TNF receptor superfamily member 12A	9598	VGNC:5943	OMA, EggNOG
Mouse	27279	Tnfrsf12a	tumor necrosis factor receptor superfamily, member 12a	10090	MGI:1351484	Inparanoid, OMA, EggNOG
Rat	302965	Tnfrsf12a	TNF receptor superfamily member 12A	10116	RGD:631329	Inparanoid, OMA, EggNOG
Dog	610734	TNFRSF12A	TNF receptor superfamily member 12A	9615	VGNC:47656	Inparanoid, OMA, EggNOG
Horse	100146755	TNFRSF12A	TNF receptor superfamily member 12A	9796	VGNC:24365	Inparanoid, OMA, EggNOG
Cow	617439	TNFRSF12A	TNF receptor superfamily member 12A	9913	VGNC:36162	Inparanoid, OMA, EggNOG
Pig	100217390	TNFRSF12A	TNF receptor superfamily member 12A	9823		Inparanoid, OMA, EggNOG
Opossum	100017750	TNFRSF12A	TNF receptor superfamily member 12A	13616		Inparanoid, OMA, EggNOG
Platypus		TNFRSF12A	TNF receptor superfamily member 12A [Source:HGNC Symbol;Acc:HGNC:18152]	9258		OMA, EggNOG

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]