The store will not work correctly when cookies are disabled.
Protein or Target Summary
Protein tyrosine phosphatase type IVA 3
| Gene ID | 11156 |
|---|
| uniprot | O75365 |
|---|
| Gene Name | PTP4A3 |
|---|
| Ensernbl ID | ENSP00000332274 |
|---|
| Family | Belongs to the protein-tyrosine phosphatase family. |
|---|
| Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 11156 | PTP4A3 | Protein tyrosine phosphatase type IVA 3 | O75365 |
| MOUSE | | Ptp4a3 | Ptp4a3 protein | Q4FK37 |
| MOUSE | 19245 | Ptp4a3 | Protein tyrosine phosphatase type IVA 3 | E9PXS4 |
| MOUSE | | Ptp4a3 | Protein tyrosine phosphatase type IVA 3 | A0A2R8VHQ8 |
| MOUSE | 19245 | Ptp4a3 | Protein tyrosine phosphatase type IVA 3 | Q9D658 |
| RAT | 362930 | Ptp4a3 | Protein tyrosine phosphatase 4a3 (Predicted), isoform CRA_a | B0K032 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
