The store will not work correctly when cookies are disabled.
PTP4A3
Description | Protein tyrosine phosphatase type IVA 3 |
---|
Gene and Protein Information
Gene ID | 11156 |
Uniprot Accession IDs | Q8IVN5 Q99849 Q9BTW5 |
Ensembl ID | ENSP00000332274 |
Symbol | PRL3 PRL3 PRL-3 PRL-R |
Family | Belongs to the protein-tyrosine phosphatase family. |
Sequence | MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 737820 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9598 | VGNC:50317 | Inparanoid, OMA, EggNOG |
Macaque | 693703 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9544 | | Inparanoid, OMA |
Mouse | 19245 | Ptp4a3 | protein tyrosine phosphatase 4a3 | 10090 | MGI:1277098 | Inparanoid, OMA, EggNOG |
Rat | 362930 | Ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 10116 | RGD:1308687 | Inparanoid, OMA, EggNOG |
Dog | 606961 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9615 | VGNC:45163 | Inparanoid, OMA, EggNOG |
Horse | 100058296 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9796 | VGNC:22006 | Inparanoid, OMA, EggNOG |
Cow | 100137722 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 9913 | VGNC:33525 | Inparanoid, OMA, EggNOG |
Opossum | 100032775 | PTP4A3 | protein tyrosine phosphatase type IVA, member 3 | 13616 | | Inparanoid, OMA, EggNOG |
Anole lizard | 100554421 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 28377 | | Inparanoid, OMA, EggNOG |
Xenopus | 100216017 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 8364 | XB-GENE-943078 | Inparanoid, OMA |
Zebrafish | 406460 | ptp4a3 | protein tyrosine phosphatase type IVA, member 3 | 7955 | ZDB-GENE-040426-2220 | Inparanoid, OMA, EggNOG |
Fruitfly | 34952 | PRL-1 | PRL-1 phosphatase | 7227 | FBgn0024734 | Inparanoid, EggNOG |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|