| Description | Tryptase alpha/beta-1 |
|---|
Gene and Protein Information
| Gene ID | 7177 |
|---|---|
| Uniprot Accession IDs | D2E6R9 D2E6S1 P15157 Q15663 Q6B052 Q9H2Y4 Q9H2Y5 Q9UQI1 Tryptase-1 |
| Ensembl ID | ENSP00000343577 |
| Symbol | TPS1 TPS2 TPSB1 TPS1 TPS2 TPSB1 TPSB2 Tryptase-2 |
| Family | Belongs to the peptidase S1 family. Tryptase subfamily. |
| Sequence | MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468084 | LOC468084 | tryptase alpha/beta-1-like | 9598 | OMA, EggNOG | |
| Macaque | 699599 | LOC699599 | tryptase alpha/beta-1 | 9544 | OMA, EggNOG | |
| Mouse | 17229 | Tpsb2 | tryptase beta 2 | 10090 | MGI:96942 | OMA, EggNOG |
| Rat | 54271 | Tpsab1 | tryptase alpha/beta 1 | 10116 | RGD:3066 | OMA, EggNOG |
| Horse | 100033966 | RET | ret proto-oncogene | 9796 | OMA, EggNOG | |
| Cow | 786948 | LOC786948 | tryptase-2-like | 9913 | OMA, EggNOG | |
| Opossum | 100022090 | LOC100022090 | tryptase alpha/beta-1-like | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / peptide hormone / Tryptase alpha/beta-1
protein / calcium-binding protein / serine protease / Tryptase alpha/beta-1
protein / calcium-binding protein / protease inhibitor / Tryptase alpha/beta-1
protein / calcium-binding protein / calmodulin / Tryptase alpha/beta-1
protein / calcium-binding protein / annexin / Tryptase alpha/beta-1
protein / calcium-binding protein / receptor / Tryptase alpha/beta-1
protein / calcium-binding protein / peptide hormone / Tryptase alpha/beta-1
protein / calcium-binding protein / serine protease / Tryptase alpha/beta-1
protein / calcium-binding protein / protease inhibitor / Tryptase alpha/beta-1
protein / calcium-binding protein / calmodulin / Tryptase alpha/beta-1
protein / calcium-binding protein / annexin / Tryptase alpha/beta-1
protein / calcium-binding protein / receptor / Tryptase alpha/beta-1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|