Protein or Target Summary

Tryptase alpha/beta-1

Gene ID	7177
uniprot	Q15661
Gene Name	TPSAB1
Ensernbl ID	ENSP00000343577
Family	Belongs to the peptidase S1 family. Tryptase subfamily.
Sequence	MLNLLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPKKP Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	7177	TPSAB1	Tryptase alpha/beta-1	Q15661
MOUSE		Tpsab1	Tryptase alpha/beta 1	Q921N4
MOUSE		Tpsab1	Tryptase	E9PY32
MOUSE	100503895	Tpsab1	Mast cell-restricted serine protease 7	A1Z090
MOUSE		Tpsab1	Tryptase alpha/beta 1, isoform CRA_a	B5A5B0
MOUSE	100503895	Tpsab1	Tryptase	Q02844
RAT	54271	Tpsab1	Tryptase	G3V8E5
RAT	54271	Tpsab1	Tryptase alpha/beta 1	Q6P6W8
RAT	54271	Tpsab1	Tryptase	P27435

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    peptide hormone    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    serine protease    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    protease inhibitor    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    calmodulin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    annexin    /    Tryptase alpha/beta-1
protein    /    calcium-binding protein    /    receptor    /    Tryptase alpha/beta-1

DTO Classes
protein / Enzyme / Protease / Serine protease / Tryptase alpha/beta-1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx