The store will not work correctly when cookies are disabled.
TNFSF9
| Description | Tumor necrosis factor ligand superfamily member 9 |
|---|
Gene and Protein Information
| Gene ID | 8744 |
|---|
| Uniprot Accession IDs | Q2M3S2 |
|---|
| Ensembl ID | ENSP00000245817 |
|---|
| Symbol | CD137L TNLG5A 4-1BB-L |
|---|
| Family | Belongs to the tumor necrosis factor family. |
|---|
| Sequence | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 700588 | TNFSF9 | TNF superfamily member 9 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 21950 | Tnfsf9 | tumor necrosis factor (ligand) superfamily, member 9 | 10090 | MGI:1101058 | Inparanoid, OMA, EggNOG |
| Rat | 353218 | Tnfsf9 | TNF superfamily member 9 | 10116 | RGD:727974 | Inparanoid, OMA, EggNOG |
| Dog | 476729 | TNFSF9 | TNF superfamily member 9 | 9615 | VGNC:47674 | Inparanoid, OMA, EggNOG |
| Horse | 102150292 | TNFSF9 | TNF superfamily member 9 | 9796 | VGNC:52031 | Inparanoid, OMA, EggNOG |
| Cow | 521748 | TNFSF9 | TNF superfamily member 9 | 9913 | VGNC:36178 | Inparanoid, OMA, EggNOG |
| Pig | 100736831 | TNFSF9 | TNF superfamily member 9 | 9823 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
