The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tumor necrosis factor ligand superfamily member 9
| Gene ID | 8744 |
|---|
| uniprot | P41273 |
|---|
| Gene Name | TNFSF9 |
|---|
| Ensernbl ID | ENSP00000245817 |
|---|
| Family | Belongs to the tumor necrosis factor family. |
|---|
| Sequence | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 8744 | TNFSF9 | Tumor necrosis factor ligand superfamily member 9 | P41273 |
| MOUSE | | Tnfsf9 | Uncharacterized protein | Q3TEQ6 |
| MOUSE | 21950 | Tnfsf9 | Tumor necrosis factor (Ligand) superfamily, member 9 | Q3U1Z9 |
| MOUSE | 21950 | Tnfsf9 | Tumor necrosis factor ligand superfamily member 9 | P41274 |
| RAT | 353218 | Tnfsf9 | TNF superfamily member 9 | Q80WE6 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
