Protein or Target Summary
Troponin C, slow skeletal and cardiac muscles
| Gene ID | 7134 |
|---|---|
| uniprot | P63316 |
| Gene Name | TNNC1 |
| Ensernbl ID | ENSP00000232975 |
| Family | Belongs to the troponin C family. |
| Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / actin family cytoskeletal protein / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / actin family cytoskeletal protein / Troponin C, slow skeletal and cardiac muscles
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Troponin C, slow skeletal and cardiac muscles
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx