TNNC1
| Description | Troponin C, slow skeletal and cardiac muscles |
|---|
Gene and Protein Information
| Gene ID | 7134 |
|---|---|
| Uniprot Accession IDs | O14800 P02590 P04463 TN-C |
| Ensembl ID | ENSP00000232975 |
| Symbol | TNNC TNC TN-C TNNC CMD1Z CMH13 |
| Family | Belongs to the troponin C family. |
| Sequence | MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 746369 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9598 | VGNC:10431 | OMA, EggNOG |
| Macaque | 697047 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 21924 | Tnnc1 | troponin C, cardiac/slow skeletal | 10090 | MGI:98779 | Inparanoid, OMA, EggNOG |
| Rat | 290561 | Tnnc1 | troponin C1, slow skeletal and cardiac type | 10116 | RGD:1309921 | Inparanoid, OMA, EggNOG |
| Dog | 476595 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9615 | VGNC:47686 | Inparanoid, OMA, EggNOG |
| Horse | 100051811 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9796 | VGNC:24388 | Inparanoid, OMA, EggNOG |
| Cow | 509486 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9913 | VGNC:36189 | Inparanoid, OMA, EggNOG |
| Pig | 100156435 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100020553 | TNNC1 | troponin C1, slow skeletal and cardiac type | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | TNNC1 | troponin C1, slow skeletal and cardiac type [Source:HGNC Symbol;Acc:HGNC:11943] | 9258 | OMA, EggNOG | ||
| Chicken | 396032 | TNNC1 | troponin C1, slow skeletal and cardiac type | 9031 | CGNC:49617 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551526 | tnnc1 | troponin C1, slow skeletal and cardiac type | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 447990 | tnnc1 | troponin C1, slow skeletal and cardiac type | 8364 | XB-GENE-480515 | Inparanoid, OMA, EggNOG |
| Zebrafish | 353247 | tnnc1a | troponin C type 1a (slow) | 7955 | ZDB-GENE-030523-1 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / actin family cytoskeletal protein / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / calcium-binding protein / actin family cytoskeletal protein / Troponin C, slow skeletal and cardiac muscles
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Troponin C, slow skeletal and cardiac muscles
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Troponin C, slow skeletal and cardiac muscles
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|