The store will not work correctly when cookies are disabled.
PIPOX
| Description | Peroxisomal sarcosine oxidase |
|---|
Gene and Protein Information
| Gene ID | 51268 |
|---|
| Uniprot Accession IDs | B3KNH0 Q96H28 Q9C070 PSO |
|---|
| Ensembl ID | ENSP00000317721 |
|---|
| Symbol | LPIPOX PSO LPIPOX |
|---|
| Family | Belongs to the MSOX/MTOX family. |
|---|
| Sequence | MAAQKDLWDAIVIGAGIQGCFTAYHLAKHRKRILLLEQFFLPHSRGSSHGQSRIIRKAYLEDFYTRMMHECYQIWAQLEHEAGTQLHRQTGLLLLGMKENQELKTIQANLSRQRVEHQCLSSEELKQRFPNIRLPRGEVGLLDNSGGVIYAYKALRALQDAIRQLGGIVRDGEKVVEINPGLLVTVKTTSRSYQAKSLVITAGPWTNQLLRPLGIEMPLQTLRINVCYWREMVPGSYGVSQAFPCFLWLGLCPHHIYGLPTGEYPGLMKVSYHHGNHADPEERDCPTARTDIGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPSLGKAHL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 454541 | PIPOX | pipecolic acid and sarcosine oxidase | 9598 | VGNC:9525 | OMA, EggNOG |
| Macaque | 711090 | PIPOX | pipecolic acid and sarcosine oxidase | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 19193 | Pipox | pipecolic acid oxidase | 10090 | MGI:1197006 | Inparanoid, OMA, EggNOG |
| Rat | 303272 | Pipox | pipecolic acid and sarcosine oxidase | 10116 | RGD:1311347 | Inparanoid, OMA, EggNOG |
| Dog | 491177 | PIPOX | pipecolic acid and sarcosine oxidase | 9615 | VGNC:44578 | Inparanoid, OMA, EggNOG |
| Horse | 100059605 | PIPOX | pipecolic acid and sarcosine oxidase | 9796 | VGNC:21469 | Inparanoid, OMA, EggNOG |
| Cow | 509102 | PIPOX | pipecolic acid and sarcosine oxidase | 9913 | VGNC:32914 | Inparanoid, OMA, EggNOG |
| Pig | 110255229 | LOC110255229 | peroxisomal sarcosine oxidase | 9823 | | OMA, EggNOG |
| Opossum | 100025469 | PIPOX | pipecolic acid and sarcosine oxidase | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | | PIPOX | pipecolic acid and sarcosine oxidase [Source:HGNC Symbol;Acc:HGNC:17804] | 9258 | | OMA, EggNOG |
| Anole lizard | | PIPOX | pipecolic acid and sarcosine oxidase [Source:HGNC Symbol;Acc:HGNC:17804] | 28377 | | Inparanoid, EggNOG |
| Xenopus | 548382 | pipox | pipecolic acid oxidase | 8364 | XB-GENE-1013122 | Inparanoid, OMA, EggNOG |
| Zebrafish | 558601 | pipox | pipecolic acid oxidase | 7955 | ZDB-GENE-110627-2 | Inparanoid, OMA, EggNOG |
| C. elegans | 180921 | C15B12.1 | Putative sarcosine oxidase | 6239 | | OMA, EggNOG |
| C. elegans | 259861 | C15B12.8 | hypothetical protein | 6239 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
