The store will not work correctly when cookies are disabled.
Protein or Target Summary
Tumor necrosis factor
| Target ID | 7777 |
|---|
| Gene ID | 7124 |
|---|
| uniprot | P01375 |
|---|
| Gene Name | TNF |
|---|
| Ensernbl ID | ENSP00000398698 |
|---|
| Family | Belongs to the tumor necrosis factor family. |
|---|
| Sequence | MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
|---|
Gene and Protein Information
Protein Classes
protein / Signaling / Cytokine / Tumor necrosis factor family member / Tumor necrosis factor
Pathway
| Data Source | Name | Explore in Pharos | Explore in Source |
|---|
