| Description | NAD-dependent protein deacylase sirtuin-5, mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 23408 |
|---|---|
| Uniprot Accession IDs | B4DFM4 B4DYJ5 F5H5Z9 Q5T294 Q5T295 Q9Y6E6 |
| Ensembl ID | ENSP00000476228 |
| Symbol | SIR2L5 SIR2L5 |
| Family | Belongs to the sirtuin family. Class III subfamily. |
| Sequence | MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 747069 | SIRT5 | sirtuin 5 | 9598 | VGNC:11282 | OMA, EggNOG |
| Macaque | 700855 | SIRT5 | sirtuin 5 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 68346 | Sirt5 | sirtuin 5 | 10090 | MGI:1915596 | Inparanoid, OMA, EggNOG |
| Rat | 306840 | Sirt5 | sirtuin 5 | 10116 | RGD:1303285 | Inparanoid, OMA, EggNOG |
| Dog | 478726 | SIRT5 | sirtuin 5 | 9615 | VGNC:46186 | Inparanoid, OMA, EggNOG |
| Horse | 100051757 | SIRT5 | sirtuin 5 | 9796 | VGNC:22990 | Inparanoid, OMA, EggNOG |
| Cow | 507347 | SIRT5 | sirtuin 5 | 9913 | VGNC:34634 | Inparanoid, OMA, EggNOG |
| Opossum | SIRT5 | NAD-dependent protein deacylase sirtuin-5, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:F7D4X9] | 13616 | Inparanoid, OMA, EggNOG | ||
| Platypus | 100084511 | SIRT5 | sirtuin 5 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 420834 | SIRT5 | sirtuin 5 | 9031 | CGNC:9629 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100562942 | sirt5 | sirtuin 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100170199 | sirt5 | sirtuin 5 | 8364 | XB-GENE-5892372 | Inparanoid, OMA, EggNOG |
| Zebrafish | 436878 | sirt5 | sirtuin 5 | 7955 | ZDB-GENE-040718-349 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / hydrolase / deacetylase / NAD-dependent protein deacylase sirtuin-5, mitochondrial
protein / hydrolase / chromatin/chromatin-binding protein / NAD-dependent protein deacylase sirtuin-5, mitochondrial
protein / hydrolase / deacetylase / NAD-dependent protein deacylase sirtuin-5, mitochondrial
protein / hydrolase / chromatin/chromatin-binding protein / NAD-dependent protein deacylase sirtuin-5, mitochondrial
DTO Classes
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class III / NAD-dependent protein deacylase sirtuin-5, mitochondrial
protein / Epigenetic regulator / Eraser / Histone deacetylase / HDAC class III / NAD-dependent protein deacylase sirtuin-5, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|