The store will not work correctly when cookies are disabled.
Protein or Target Summary
CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
| Gene ID | 6487 |
|---|
| uniprot | Q11203 |
|---|
| Gene Name | ST3GAL3 |
|---|
| Ensernbl ID | ENSP00000262915 |
|---|
| Family | Belongs to the glycosyltransferase 29 family. |
|---|
| Sequence | MGLLVFVRNLLLALCLFLVLGFLYYSAWKLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKYANFSEGACKPGYASALMTAIFPRFSKPAPMFLDDSFRKWARIREFVPPFGIKGQDNLIKAILSVTKEYRLTPALDSLRCRRCIIVGNGGVLANKSLGSRIDDYDIVVRLNSAPVKGFEKDVGSKTTLRITYPEGAMQRPEQYERDSLFVLAGFKWQDFKWLKYIVYKERVSASDGFWKSVATRVPKEPPEIRILNPYFIQEAAFTLIGLPFNNGLMGRGNIPTLGSVAVTMALHGCDEVAVAGFGYDMSTPNAPLHYYETVRMAAIKESWTHNIQREKEFLRKLVKARVITDLSSGI Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6487 | ST3GAL3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | Q11203 |
| MOUSE | 20441 | St3gal3 | Uncharacterized protein | Q9DBB6 |
| MOUSE | | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | F6XZQ5 |
| MOUSE | 20441 | St3gal3 | Uncharacterized protein | Q3UWD5 |
| MOUSE | | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | B1AS81 |
| MOUSE | 20441 | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | Q9CZ48 |
| MOUSE | 20441 | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | P97325 |
| RAT | 64445 | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | F1LM32 |
| RAT | 64445 | St3gal3 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | Q02734 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
