The store will not work correctly when cookies are disabled.
Protein or Target Summary
Serpin B3
| Gene ID | 6317 |
|---|
| uniprot | P29508 |
|---|
| Gene Name | SERPINB3 |
|---|
| Ensernbl ID | ENSP00000283752 |
|---|
| Family | Belongs to the serpin family. Ov-serpin subfamily. |
|---|
| Sequence | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6317 | SERPINB3 | Serpin B3 | P29508 |
| RAT | 304688 | Serpinb3 | Serine protease inhibitor B3 | Q6IE44 |
| RAT | | Serpinb3 | Serpin family B member 3 | F1MAA9 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
