Protein or Target Summary

Transcription factor PU.1

Gene ID	6688
uniprot	P17947
Gene Name	SPI1
Ensernbl ID	ENSP00000227163
Family	Belongs to the ETS family.
Sequence	MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	6688	SPI1	Transcription factor PU.1	P17947
MOUSE		Spi1	Transcription factor PU.1	E9QAI9
MOUSE		Spi1	Transcription factor PU.1	E9Q6W1
MOUSE	20375	Spi1	SFFV proviral integration 1	Q3U5L4
MOUSE	20375	Spi1	Transcription factor PU.1	P17433
RAT	366126	Spi1	Transcription factor PU.1	Q6BDS1

Protein Classes

PANTHER Classes
protein    /    transcription factor    /    Transcription factor PU.1
protein    /    signaling molecule    /    Transcription factor PU.1
protein    /    winged helix/forkhead transcription factor    /    Transcription factor PU.1
protein    /    nucleic acid binding    /    Transcription factor PU.1

DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Transcription factor PU.1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: TCRDv6_DataSourcesLicenses.xlsx