SPI1
| Description | Transcription factor PU.1 |
|---|
Gene and Protein Information
| Gene ID | 6688 |
|---|---|
| Uniprot Accession IDs | P17947 |
| Ensembl ID | ENSP00000227163 |
| Symbol | OF PU.1 SFPI1 SPI-1 SPI-A |
| Family | Belongs to the ETS family. |
| Sequence | MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 20375 | Spi1 | spleen focus forming virus (SFFV) proviral integration oncogene | 10090 | MGI:98282 | Inparanoid, OMA, EggNOG |
| Rat | 366126 | Spi1 | Spi-1 proto-oncogene | 10116 | RGD:1359607 | Inparanoid, OMA, EggNOG |
| Dog | 611255 | SPI1 | Spi-1 proto-oncogene | 9615 | VGNC:52051 | Inparanoid, OMA, EggNOG |
| Horse | 100051397 | SPI1 | Spi-1 proto-oncogene | 9796 | VGNC:23519 | OMA, EggNOG |
| Cow | 507100 | SPI1 | Spi-1 proto-oncogene | 9913 | VGNC:35213 | Inparanoid, OMA, EggNOG |
| Pig | 414912 | SPI1 | Spi-1 proto-oncogene | 9823 | Inparanoid, OMA | |
| Opossum | 100016353 | SPI1 | Spi-1 proto-oncogene | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 395879 | SPI1 | Spi-1 proto-oncogene | 9031 | CGNC:6161 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100551710 | spi1 | Spi-1 proto-oncogene | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100125218 | spi1 | Spi-1 proto-oncogene | 8364 | XB-GENE-1018247 | Inparanoid, OMA, EggNOG |
| Zebrafish | 30117 | spi1b | Spi-1 proto-oncogene b | 7955 | ZDB-GENE-980526-164 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / Transcription factor PU.1
protein / signaling molecule / Transcription factor PU.1
protein / winged helix/forkhead transcription factor / Transcription factor PU.1
protein / nucleic acid binding / Transcription factor PU.1
protein / transcription factor / Transcription factor PU.1
protein / signaling molecule / Transcription factor PU.1
protein / winged helix/forkhead transcription factor / Transcription factor PU.1
protein / nucleic acid binding / Transcription factor PU.1
DTO Classes
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Transcription factor PU.1
protein / Transcription factor / Helix-turn-helix transcription factor / Winged helix/forkhead transcription factor / Transcription factor PU.1
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|