Protein or Target Summary
Ectonucleoside triphosphate diphosphohydrolase 2
| Gene ID | 954 |
|---|---|
| uniprot | Q9Y5L3 |
| Gene Name | ENTPD2 |
| Ensernbl ID | ENSP00000347213 |
| Family | Belongs to the GDA1/CD39 NTPase family. |
| Sequence | MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 954 | ENTPD2 | Ectonucleoside triphosphate diphosphohydrolase 2 | Q9Y5L3 |
| MOUSE | 12496 | Entpd2 | Ectonucleoside triphosphate diphosphohydrolase 2 | O55026 |
| MOUSE | Entpd2 | Uncharacterized protein | Q3T9U8 | |
| MOUSE | 12496 | Entpd2 | Ectonucleoside triphosphate diphosphohydrolase 2 | Q921R1 |
| RAT | 64467 | Entpd2 | Ectonucleoside triphosphate diphosphohydrolase 2 | O35795 |
| RAT | 64467 | Entpd2 | Ectonucleoside triphosphate diphosphohydrolase 2 | F1M7N2 |
| RAT | Entpd2 | Nucleoside triphosphate diphosphohydrolase 2 | A3FKJ7 | |
| RAT | Entpd2 | Ectonucleoside triphosphate diphosphohydrolase 2 | Q5RJP4 |
Protein Classes
PANTHER Classes
protein / nucleotide phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / hydrolase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / nucleotide phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / hydrolase / Ectonucleoside triphosphate diphosphohydrolase 2
DTO Classes
protein / Enzyme / Hydrolase / Phosphatase / Nucleotide phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
protein / Enzyme / Hydrolase / Phosphatase / Nucleotide phosphatase / Ectonucleoside triphosphate diphosphohydrolase 2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx