Call +1 (833) 552-7181 or Contact us Earn $25 in coupons on your first order with Aladdin!
Toggle Nav
My Cart
Search
Advanced Search
Menu
Sign In
྾

ENTPD2

DescriptionEctonucleoside triphosphate diphosphohydrolase 2

Gene and Protein Information

Gene ID954
Uniprot Accession IDs O15464 Q5SPY6 Q5SPY7 NTPDase 2
Ensembl ID ENSP00000347213
Symbol CD39L1 CD39L1 NTPDase-2
FamilyBelongs to the GDA1/CD39 NTPase family.
Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464883ENTPD2ectonucleoside triphosphate diphosphohydrolase 29598VGNC:13876OMA, EggNOG
Macaque721617ENTPD2ectonucleoside triphosphate diphosphohydrolase 29544Inparanoid, OMA, EggNOG
Mouse12496Entpd2ectonucleoside triphosphate diphosphohydrolase 210090MGI:1096863Inparanoid, OMA, EggNOG
Rat64467Entpd2ectonucleoside triphosphate diphosphohydrolase 210116RGD:69266Inparanoid, OMA, EggNOG
Dog491241ENTPD2ectonucleoside triphosphate diphosphohydrolase 29615VGNC:40381Inparanoid, OMA, EggNOG
Horse100066152ENTPD2ectonucleoside triphosphate diphosphohydrolase 29796VGNC:17596Inparanoid, OMA, EggNOG
Cow100126045ENTPD2ectonucleoside triphosphate diphosphohydrolase 29913VGNC:28509Inparanoid, OMA, EggNOG
Opossum100022598ENTPD2ectonucleoside triphosphate diphosphohydrolase 213616Inparanoid, EggNOG
Anole lizard100561926LOC100561926ectonucleoside triphosphate diphosphohydrolase 228377OMA, EggNOG
Xenopus407961entpd2ectonucleoside triphosphate diphosphohydrolase 28364XB-GENE-5810181Inparanoid, OMA, EggNOG
Zebrafish447905entpd2a.1ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 17955ZDB-GENE-040724-187OMA, EggNOG
Zebrafish569142entpd2bectonucleoside triphosphate diphosphohydrolase 2b7955ZDB-GENE-061013-2Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleotide phosphatase    /    Ectonucleoside triphosphate diphosphohydrolase 2
protein    /    phosphatase    /    Ectonucleoside triphosphate diphosphohydrolase 2
protein    /    hydrolase    /    Ectonucleoside triphosphate diphosphohydrolase 2
DTO Classes
protein    /    Enzyme    /    Hydrolase    /    Phosphatase    /    Nucleotide phosphatase    /    Ectonucleoside triphosphate diphosphohydrolase 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source
      🔙[Back to Target (Human)]
      Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
      Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
      Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.