JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Mothers against decapentaplegic homolog 5

Gene ID	4090
uniprot	Q99717
Gene Name	SMAD5
Ensernbl ID	ENSP00000441954
Family	Belongs to the dwarfin/SMAD family.
Sequence	MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4090	SMAD5	Mothers against decapentaplegic homolog 5	Q99717
MOUSE		Smad5	Mothers against decapentaplegic homolog	Q9CRR7
MOUSE		Smad5	Madh5 protein	Q810W4
MOUSE	17129	Smad5	Mothers against decapentaplegic homolog 5	P97454
RAT		Smad5	Smad5 protein	Q6IRI8
RAT	59328	Smad5	Mothers against decapentaplegic homolog	B1WBR0
RAT	59328	Smad5	Mothers against decapentaplegic homolog 5	Q9R1V3

Protein Classes

PANTHER Classes
protein / transcription factor / Mothers against decapentaplegic homolog 5

DTO Classes
protein / Transcription factor / Mothers against decapentaplegic homolog 5

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx