The store will not work correctly when cookies are disabled.
Protein or Target Summary
Calcineurin B homologous protein 1
| Gene ID | 11261 |
|---|
| uniprot | Q99653 |
|---|
| Gene Name | CHP1 |
|---|
| Ensernbl ID | ENSP00000335632 |
|---|
| Family | Belongs to the calcineurin regulatory subunit family. CHP subfamily. |
|---|
| Sequence | MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFLH Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 11261 | CHP1 | Calcineurin B homologous protein 1 | Q99653 |
| MOUSE | 56398 | Chp1 | Calcineurin B homologous protein 1 | P61022 |
| MOUSE | | Chp1 | Calcineurin B homologous protein 1 | B0R092 |
| MOUSE | | Chp1 | Calcineurin B homologous protein 1 | B0R091 |
| RAT | 64152 | Chp1 | Calcineurin B homologous protein 1 | P61023 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
