The store will not work correctly when cookies are disabled.
Gene and Protein Information
| Gene ID | 54863 |
|---|
| Uniprot Accession IDs | A2BFA4 |
|---|
| Ensembl ID | ENSP00000350102 |
|---|
| Symbol | C9orf167 C9orf167 |
|---|
| Family | Belongs to the ClpA/ClpB family. Torsin subfamily. |
|---|
| Sequence | MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRDYLATHVHSRPLLLALHGPSGVGKSHVGRLLARHFRSVLEDSALVLQYHARHHCPEARAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQPQRSHHFHNAIYVLLSGAGGAEVTRFVLQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWQAAAIVPFLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAVTGCKQVVATVNLL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 704865 | TOR4A | torsin family 4 member A | 9544 | | OMA, EggNOG |
| Mouse | 227612 | Tor4a | torsin family 4, member A | 10090 | MGI:2442720 | Inparanoid, OMA, EggNOG |
| Rat | 311795 | Tor4a | torsin family 4, member A | 10116 | RGD:1308019 | Inparanoid, OMA, EggNOG |
| Dog | 491229 | TOR4A | torsin family 4 member A | 9615 | VGNC:47716 | Inparanoid, OMA, EggNOG |
| Horse | | TOR4A | torsin family 4 member A [Source:HGNC Symbol;Acc:HGNC:25981] | 9796 | | OMA, EggNOG |
| Cow | 618444 | TOR4A | torsin family 4 member A | 9913 | VGNC:36227 | OMA, EggNOG |
| Pig | 100514387 | TOR4A | torsin family 4 member A | 9823 | | OMA, EggNOG |
| Opossum | 103095994 | TOR4A | torsin family 4 member A | 13616 | | Inparanoid, EggNOG |
| Platypus | | TOR4A | torsin family 4 member A [Source:HGNC Symbol;Acc:HGNC:25981] | 9258 | | OMA, EggNOG |
| Chicken | 417257 | TOR4A | torsin family 4 member A | 9031 | CGNC:6546 | OMA, EggNOG |
| Anole lizard | 100556226 | tor4a | torsin family 4 member A | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 594988 | tor4a | torsin family 4, member A | 8364 | XB-GENE-975360 | Inparanoid, OMA, EggNOG |
| Zebrafish | 550133 | tor4aa | torsin family 4, member Aa | 7955 | ZDB-GENE-050417-9 | OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
chaperone / Torsin-4A
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
