JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Mothers against decapentaplegic homolog 7

Gene ID	4092
uniprot	O15105
Gene Name	SMAD7
Ensernbl ID	ENSP00000262158
Family	Belongs to the dwarfin/SMAD family.
Sequence	MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4092	SMAD7	Mothers against decapentaplegic homolog 7	O15105
MOUSE		Smad7	Mothers against decapentaplegic homolog 7	G3UX42
MOUSE		Smad7	Mothers against decapentaplegic homolog 7	G3UXH8
MOUSE	17131	Smad7	Mothers against decapentaplegic homolog	B2RPW6
MOUSE	17131	Smad7	Mothers against decapentaplegic homolog 7	O35253
RAT	81516	Smad7	Mothers against decapentaplegic homolog	A0A0G2JSQ5
RAT	81516	Smad7	Mothers against decapentaplegic homolog 7	O88406

Protein Classes

PANTHER Classes
protein / transcription factor / Mothers against decapentaplegic homolog 7

DTO Classes
protein / Transcription factor / Mothers against decapentaplegic homolog 7

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx