The store will not work correctly when cookies are disabled.
SOD2
| Description | Superoxide dismutase [Mn], mitochondrial |
|---|
Gene and Protein Information
| Gene ID | 6648 |
|---|
| Uniprot Accession IDs | B2R7R1 B3KUK2 B4DL20 B4E3K9 E1P5A9 P78434 Q16792 Q5TCM1 Q96EE6 Q9P2Z3 |
|---|
| Ensembl ID | ENSP00000446252 |
|---|
| Symbol | IPOB IPO-B MNSOD MVCD6 Mn-SOD |
|---|
| Family | Belongs to the iron/manganese superoxide dismutase family. |
|---|
| Sequence | MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 449634 | SOD2 | superoxide dismutase 2 | 9598 | VGNC:52105 | Inparanoid, OMA, EggNOG |
| Macaque | 574097 | SOD2 | superoxide dismutase 2 | 9544 | | Inparanoid, EggNOG |
| Mouse | 20656 | Sod2 | superoxide dismutase 2, mitochondrial | 10090 | MGI:98352 | Inparanoid, OMA, EggNOG |
| Rat | 24787 | Sod2 | superoxide dismutase 2 | 10116 | RGD:3732 | Inparanoid, OMA, EggNOG |
| Dog | 476258 | SOD2 | superoxide dismutase 2 | 9615 | VGNC:53988 | OMA, EggNOG |
| Horse | 100034223 | SOD2 | superoxide dismutase 2 | 9796 | | Inparanoid, OMA, EggNOG |
| Cow | 281496 | SOD2 | superoxide dismutase 2, mitochondrial | 9913 | | Inparanoid, EggNOG |
| Opossum | 100032426 | SOD2 | superoxide dismutase 2 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 374042 | SOD2 | superoxide dismutase 2, mitochondrial | 9031 | CGNC:8863 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100556234 | sod2 | superoxide dismutase 2 | 28377 | | Inparanoid, OMA, EggNOG |
| Xenopus | 448200 | sod2 | superoxide dismutase 2 | 8364 | XB-GENE-1000989 | Inparanoid, OMA, EggNOG |
| Zebrafish | 335799 | sod2 | superoxide dismutase 2, mitochondrial | 7955 | ZDB-GENE-030131-7742 | Inparanoid, OMA, EggNOG |
| C. elegans | 172632 | sod-2 | Superoxide dismutase [Mn] 1, mitochondrial | 6239 | | OMA, EggNOG |
| C. elegans | 181748 | sod-3 | Superoxide dismutase [Mn] 2, mitochondrial | 6239 | | Inparanoid, OMA |
| Fruitfly | 36878 | Sod2 | Superoxide dismutase 2 (Mn) | 7227 | FBgn0010213 | Inparanoid, EggNOG |
| S.cerevisiae | 856399 | SOD2 | superoxide dismutase SOD2 | 4932 | S000001050 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes protein /
oxidoreductase / Superoxide dismutase [Mn], mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
