JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Mothers against decapentaplegic homolog 1

Gene ID	4086
uniprot	Q15797
Gene Name	SMAD1
Ensernbl ID	ENSP00000426568
Family	Belongs to the dwarfin/SMAD family.
Sequence	MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	4086	SMAD1	Mothers against decapentaplegic homolog 1	Q15797
MOUSE		Smad1	Mothers against decapentaplegic homolog	Q8C3Y6
MOUSE	17125	Smad1	Mothers against decapentaplegic homolog 1	P70340
RAT	25671	Smad1	Mothers against decapentaplegic homolog	Q6P7A6
RAT		Smad1	Mothers against decapentaplegic homolog	A0A0G2JSQ6
RAT		Smad1	Mothers against decapentaplegic homolog 1	P97588

Protein Classes

PANTHER Classes
protein / transcription factor / Mothers against decapentaplegic homolog 1

DTO Classes
protein / Transcription factor / Mothers against decapentaplegic homolog 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx