GPR35

DescriptionG-protein coupled receptor 35

Gene and Protein Information

Gene ID2859
Uniprot Accession IDs J3KR30 O43495 Q17R58 Q4VBN5 Q4ZFV2 Q6FHI8 Q86UH4
Ensembl ID ENSP00000411788
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp460070GPR35G protein-coupled receptor 359598VGNC:1951OMA, EggNOG
Macaque699073GPR35G protein-coupled receptor 359544Inparanoid, OMA, EggNOG
Mouse64095Gpr35G protein-coupled receptor 3510090MGI:1929509Inparanoid, OMA, EggNOG
Rat367315Gpr35G protein-coupled receptor 3510116RGD:1309404Inparanoid, OMA, EggNOG
Dog100855802LOC100855802G-protein coupled receptor 35-like9615OMA, EggNOG
HorseGPR35G protein-coupled receptor 35 [Source:HGNC Symbol;Acc:HGNC:4492]9796OMA, EggNOG
Cow505056GPR35G protein-coupled receptor 359913VGNC:29584Inparanoid, OMA, EggNOG
Opossum100021803LOC100021803G-protein coupled receptor 35-like13616OMA, EggNOG
Platypus100080746GPR35G protein-coupled receptor 359258OMA, EggNOG
Anole lizard100557680gpr35G protein-coupled receptor 3528377Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 35

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source