The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
GPR35
Description | G-protein coupled receptor 35 |
---|
Gene and Protein Information
Gene ID | 2859 |
Uniprot Accession IDs | J3KR30 O43495 Q17R58 Q4VBN5 Q4ZFV2 Q6FHI8 Q86UH4 |
Ensembl ID | ENSP00000411788 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLLCTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVLWVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMAKEFQEASALAVAPSAKAHKSQDSLCVTLA Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Chimp | 460070 | GPR35 | G protein-coupled receptor 35 | 9598 | VGNC:1951 | OMA, EggNOG |
Macaque | 699073 | GPR35 | G protein-coupled receptor 35 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 64095 | Gpr35 | G protein-coupled receptor 35 | 10090 | MGI:1929509 | Inparanoid, OMA, EggNOG |
Rat | 367315 | Gpr35 | G protein-coupled receptor 35 | 10116 | RGD:1309404 | Inparanoid, OMA, EggNOG |
Dog | 100855802 | LOC100855802 | G-protein coupled receptor 35-like | 9615 | | OMA, EggNOG |
Horse | | GPR35 | G protein-coupled receptor 35 [Source:HGNC Symbol;Acc:HGNC:4492] | 9796 | | OMA, EggNOG |
Cow | 505056 | GPR35 | G protein-coupled receptor 35 | 9913 | VGNC:29584 | Inparanoid, OMA, EggNOG |
Opossum | 100021803 | LOC100021803 | G-protein coupled receptor 35-like | 13616 | | OMA, EggNOG |
Platypus | 100080746 | GPR35 | G protein-coupled receptor 35 | 9258 | | OMA, EggNOG |
Anole lizard | 100557680 | gpr35 | G protein-coupled receptor 35 | 28377 | | Inparanoid, OMA |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Availability | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | Application | Availability | View Details |
---|
The page will load shortly, Thanks for your patience!
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!
Bibliography
The page will load shortly, Thanks for your patience!