The store will not work correctly when cookies are disabled.
Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.
GPR3
Description | G-protein coupled receptor 3 |
---|
Gene and Protein Information
Gene ID | 2827 |
Uniprot Accession IDs | A8K570 |
Ensembl ID | ENSP00000363136 |
Symbol | ACCA ACCA |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV Show more |
---|
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
Macaque | 716033 | GPR3 | G protein-coupled receptor 3 | 9544 | | Inparanoid, OMA, EggNOG |
Mouse | 14748 | Gpr3 | G-protein coupled receptor 3 | 10090 | MGI:101908 | Inparanoid, OMA, EggNOG |
Rat | 266769 | Gpr3 | G protein-coupled receptor 3 | 10116 | RGD:628686 | Inparanoid, OMA |
Dog | 487344 | GPR3 | G protein-coupled receptor 3 | 9615 | VGNC:41429 | Inparanoid, OMA |
Horse | 100070910 | GPR3 | G protein-coupled receptor 3 | 9796 | VGNC:18538 | Inparanoid, OMA |
Cow | 540687 | GPR3 | G protein-coupled receptor 3 | 9913 | VGNC:29581 | Inparanoid, OMA |
Pig | 100512611 | GPR3 | G protein-coupled receptor 3 | 9823 | | Inparanoid, OMA |
Anole lizard | 100552746 | gpr3 | G protein-coupled receptor 3 | 28377 | | Inparanoid, OMA |
Associated Recombinant Proteins
Associated Approved Drugs
Associated Active Ligands
The page will load shortly, Thanks for your patience!
The page will load shortly, Thanks for your patience!
Associated Diseases
Name | Direct Associated Targets | Disease Type | Mondoid |
---|
The page will load shortly, Thanks for your patience!