Your company account is blocked and you cannot place orders. If you have questions, please contact your company administrator.

GPR3

DescriptionG-protein coupled receptor 3

Gene and Protein Information

Gene ID2827
Uniprot Accession IDs A8K570
Ensembl ID ENSP00000363136
Symbol ACCA ACCA
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MMWGAGSPLAWLSAGSGNVNVSSVGPAEGPTGPAAPLPSPKAWDVVLCISGTLVSCENALVVAIIVGTPAFRAPMFLLVGSLAVADLLAGLGLVLHFAAVFCIGSAEMSLVLVGVLAMAFTASIGSLLAITVDRYLSLYNALTYYSETTVTRTYVMLALVWGGALGLGLLPVLAWNCLDGLTTCGVVYPLSKNHLVVLAIAFFMVFGIMLQLYAQICRIVCRHAQQIALQRHLLPASHYVATRKGIATLAVVLGAFAACWLPFTVYCLLGDAHSPPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRSRSPSDV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque716033GPR3G protein-coupled receptor 39544Inparanoid, OMA, EggNOG
Mouse14748Gpr3G-protein coupled receptor 310090MGI:101908Inparanoid, OMA, EggNOG
Rat266769Gpr3G protein-coupled receptor 310116RGD:628686Inparanoid, OMA
Dog487344GPR3G protein-coupled receptor 39615VGNC:41429Inparanoid, OMA
Horse100070910GPR3G protein-coupled receptor 39796VGNC:18538Inparanoid, OMA
Cow540687GPR3G protein-coupled receptor 39913VGNC:29581Inparanoid, OMA
Pig100512611GPR3G protein-coupled receptor 39823Inparanoid, OMA
Anole lizard100552746gpr3G protein-coupled receptor 328377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 3
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 3

Associated Approved Drugs

    Associated Active Ligands

    The page will load shortly, Thanks for your patience!
    The page will load shortly, Thanks for your patience!

      Associated Diseases

      The page will load shortly, Thanks for your patience!
      NameDirect Associated TargetsDisease TypeMondoid