The store will not work correctly when cookies are disabled.
SENP8
| Description | Sentrin-specific protease 8 |
|---|
Gene and Protein Information
| Gene ID | 123228 |
|---|
| Uniprot Accession IDs | Q96QA4 |
|---|
| Ensembl ID | ENSP00000340505 |
|---|
| Symbol | DEN1 NEDP1 PRSC2 DEN1 NEDP1 PRSC2 |
|---|
| Family | Belongs to the peptidase C48 family. |
|---|
| Sequence | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Macaque | 697613 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 71599 | Senp8 | SUMO/sentrin specific peptidase 8 | 10090 | MGI:1918849 | Inparanoid, OMA, EggNOG |
| Rat | 315723 | Senp8 | SUMO peptidase family member, NEDD8 specific | 10116 | RGD:1309955 | Inparanoid, OMA, EggNOG |
| Dog | 487631 | SENP8 | SUMO peptidase family member, NEDD8 specific | 9615 | VGNC:46008 | Inparanoid, OMA, EggNOG |
| Horse | 100052291 | SENP8 | SUMO peptidase family member, NEDD8 specific | 9796 | VGNC:22826 | Inparanoid, OMA, EggNOG |
| Cow | 782385 | LOC782385 | sentrin-specific protease 8 | 9913 | | Inparanoid, OMA, EggNOG |
| Pig | 100625525 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9823 | | OMA, EggNOG |
| Opossum | 100013705 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 13616 | | Inparanoid, EggNOG |
| Platypus | 100079737 | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific | 9258 | | Inparanoid, OMA, EggNOG |
| Anole lizard | | SENP8 | SUMO/sentrin peptidase family member, NEDD8 specific [Source:HGNC Symbol;Acc:HGNC:22992] | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 565126 | senp8 | SUMO peptidase family member, NEDD8 specific | 7955 | ZDB-GENE-060929-1186 | OMA, EggNOG |
| C. elegans | 3565434 | ulp-3 | Ubiquitin-Like Protease | 6239 | | Inparanoid, OMA, EggNOG |
| Fruitfly | 36339 | Den1 | Deneddylase 1 | 7227 | FBgn0033716 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
