JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Sentrin-specific protease 8

Gene ID	123228
uniprot	Q96LD8
Gene Name	SENP8
Ensernbl ID	ENSP00000340505
Family	Belongs to the peptidase C48 family.
Sequence	MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	123228	SENP8	Sentrin-specific protease 8	Q96LD8
MOUSE	71599	Senp8	Uncharacterized protein	Q3UWN3
MOUSE		Senp8	Sentrin-specific protease 8	A0A1L1ST73
MOUSE	71599	Senp8	Sentrin-specific protease 8	A0A1L1SRH8
MOUSE	71599	Senp8	SUMO/sentrin specific peptidase 8, isoform CRA_a	A0A0R4J234
MOUSE	71599	Senp8	Sentrin-specific protease 8	Q9D2Z4
RAT	315723	Senp8	Sentrin-specific protease 8	Q5FVJ8

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx