| Description | Protein S100-A10 |
|---|
Gene and Protein Information
| Gene ID | 6281 |
|---|---|
| Uniprot Accession IDs | A8K4V8 P08206 Q5T1C5 |
| Ensembl ID | ENSP00000357801 |
| Symbol | ANX2LG CAL1L CLP11 42C P11 p10 GP11 ANX2L CAL1L CLP11 Ca[1] ANX2LG |
| Family | Belongs to the S-100 family. |
| Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457306 | S100A10 | S100 calcium binding protein A10 | 9598 | VGNC:1522 | OMA, EggNOG |
| Mouse | 20194 | S100a10 | S100 calcium binding protein A10 (calpactin) | 10090 | MGI:1339468 | Inparanoid, OMA, EggNOG |
| Rat | 81778 | S100a10 | S100 calcium binding protein A10 | 10116 | RGD:628655 | Inparanoid, OMA |
| Dog | 475851 | S100A10 | S100 calcium binding protein A10 | 9615 | Inparanoid, OMA | |
| Horse | 100034012 | S100A10 | S100 calcium binding protein A10 | 9796 | VGNC:22646 | Inparanoid, OMA, EggNOG |
| Cow | 282466 | S100A10 | S100 calcium binding protein A10 | 9913 | VGNC:34237 | Inparanoid, OMA, EggNOG |
| Pig | 100515138 | S100A10 | S100 calcium binding protein A10 | 9823 | OMA, EggNOG | |
| Opossum | 100016292 | S100A10 | S100 calcium binding protein A10 | 13616 | OMA, EggNOG | |
| Anole lizard | 100564227 | s100a10 | S100 calcium binding protein A10 | 28377 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / calcium-binding protein / calmodulin / Protein S100-A10
protein / calcium-binding protein / signaling molecule / Protein S100-A10
protein / calcium-binding protein / calmodulin / Protein S100-A10
protein / calcium-binding protein / signaling molecule / Protein S100-A10
DTO Classes
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A10
protein / Calcium-binding protein / Intracellular calcium-sensing protein / Calmodulin / Protein S100-A10
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|