JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
GPR55

GPR55

Description	G-protein coupled receptor 55

Gene and Protein Information

Gene ID	9290
Uniprot Accession IDs	Q8N580
Ensembl ID	ENSP00000375894
Symbol	LPIR1
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	470673	GPR55	G protein-coupled receptor 55	9598	VGNC:10832	OMA, EggNOG
Mouse	227326	Gpr55	G protein-coupled receptor 55	10090	MGI:2685064	Inparanoid, OMA, EggNOG
Rat	501177	Gpr55	G protein-coupled receptor 55	10116	RGD:1559828	Inparanoid, OMA, EggNOG
Dog	486157	GPR55	G protein-coupled receptor 55	9615	VGNC:41438	Inparanoid, OMA, EggNOG
Horse		GPR55	G protein-coupled receptor 55 [Source:HGNC Symbol;Acc:HGNC:4511]	9796		OMA, EggNOG
Cow	539107	GPR55	G protein-coupled receptor 55	9913	VGNC:29591	Inparanoid, OMA, EggNOG
Opossum	100021880	GPR55	G protein-coupled receptor 55	13616		Inparanoid, OMA, EggNOG
Chicken	770641	GPR55	G protein-coupled receptor 55	9031	CGNC:4131	Inparanoid, OMA, EggNOG
Xenopus		gpr55	G protein-coupled receptor 55 [Source:Xenbase;Acc:XB-GENE-1011165]	8364		OMA, EggNOG

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 55

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]