JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

G-protein coupled receptor 55

Gene ID	9290
uniprot	Q9Y2T6
Gene Name	GPR55
Ensernbl ID	ENSP00000375894
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	9290	GPR55	G-protein coupled receptor 55	Q9Y2T6
MOUSE	227326	Gpr55	G-protein coupled receptor 55	Q3UJF0
MOUSE		Gpr55	G protein-coupled receptor 55	Q14BW0
MOUSE	227326	Gpr55	G protein-coupled receptor 55	Q14BV9
RAT		GPR55	G protein-coupled receptor	Q9WU09
RAT	501177	Gpr55	G protein-coupled receptor 55	F1MAK4

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 55

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx