The store will not work correctly when cookies are disabled.
Protein or Target Summary
Diamine acetyltransferase 1
| Gene ID | 6303 |
|---|
| uniprot | P21673 |
|---|
| Gene Name | SAT1 |
|---|
| Ensernbl ID | ENSP00000368572 |
|---|
| Family | Belongs to the acetyltransferase family. |
|---|
| Sequence | MAKFVIRPATAADCSDILRLIKELAKYEYMEEQVILTEKDLLEDGFGEHPFYHCLVAEVPKEHWTPEGHSIVGFAMYYFTYDPWIGKLLYLEDFFVMSDYRGFGIGSEILKNLSQVAMRCRCSSMHFLVAEWNEPSINFYKRRGASDLSSEEGWRLFKIDKEYLLKMATEE Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6303 | SAT1 | Diamine acetyltransferase 1 | P21673 |
| MOUSE | 20229 | Sat1 | Uncharacterized protein | Q3V2Q2 |
| MOUSE | | Sat1 | Diamine acetyltransferase 1 | S4R2T2 |
| MOUSE | | Sat1 | Diamine acetyltransferase 1 | A2BES2 |
| MOUSE | 20229 | Sat1 | Diamine acetyltransferase 1 | P48026 |
| RAT | 302642 | Sat1 | Spermidine/spermine N1-acetyl transferase (Mapped), isoform CRA_c | Q6P9U6 |
| RAT | | Sat1 | Ab2-402 | Q7TP41 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
