Protein or Target Summary
Amiloride-sensitive sodium channel subunit beta
Gene ID | 6338 |
---|---|
uniprot | P51168 |
Gene Name | SCNN1B |
Ensernbl ID | ENSP00000345751 |
Family | Belongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily. |
Sequence | MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI Show more |
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|---|---|---|---|
HUMAN | 6338 | SCNN1B | Amiloride-sensitive sodium channel subunit beta | P51168 |
MOUSE | Scnn1b | Amiloride-sensitive sodium channel subunit beta | A0A0U1RNR9 | |
MOUSE | 20277 | Scnn1b | Sodium channel, nonvoltage-gated 1 beta | A2RS45 |
MOUSE | Scnn1b | Amiloride-sensitive sodium channel subunit beta | Q3TP51 | |
MOUSE | 20277 | Scnn1b | Amiloride-sensitive sodium channel subunit beta | Q9WU38 |
RAT | 24767 | Scnn1b | Amiloride sensitive sodium channel beta1 subunit | B8QP48 |
RAT | 24767 | Scnn1b | Amiloride-sensitive sodium channel subunit beta | P37090 |
Protein Classes
PANTHER Classes
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit beta
protein / transporter / ion channel / Amiloride-sensitive sodium channel subunit beta
DTO Classes
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1B subfamily / Amiloride-sensitive sodium channel subunit beta
protein / Ion channel / Amiloride-sensitive sodium channel family / SCNN1B subfamily / Amiloride-sensitive sodium channel subunit beta
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx