Click Here for 5% Off Your First Aladdin Purchase!

Protein or Target Summary

Amiloride-sensitive sodium channel subunit beta

Gene ID6338
uniprotP51168
Gene NameSCNN1B
Ensernbl IDENSP00000345751
FamilyBelongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.
Sequence
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Show more

Gene and Protein Information

SpeciesGene IDGene SymbolGene NameUniprot
HUMAN6338SCNN1BAmiloride-sensitive sodium channel subunit betaP51168
MOUSEScnn1bAmiloride-sensitive sodium channel subunit betaA0A0U1RNR9
MOUSE20277Scnn1bSodium channel, nonvoltage-gated 1 betaA2RS45
MOUSEScnn1bAmiloride-sensitive sodium channel subunit betaQ3TP51
MOUSE20277Scnn1bAmiloride-sensitive sodium channel subunit betaQ9WU38
RAT24767Scnn1bAmiloride sensitive sodium channel beta1 subunitB8QP48
RAT24767Scnn1bAmiloride-sensitive sodium channel subunit betaP37090

Protein Classes

PANTHER Classes
protein    /    transporter    /    ion channel    /    Amiloride-sensitive sodium channel subunit beta
DTO Classes
protein    /    Ion channel    /    Amiloride-sensitive sodium channel family    /    SCNN1B subfamily    /    Amiloride-sensitive sodium channel subunit beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source