JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

G-protein coupled receptor 6

Gene ID	2830
uniprot	P46095
Gene Name	GPR6
Ensernbl ID	ENSP00000406986
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	2830	GPR6	G-protein coupled receptor 6	P46095
MOUSE	140741	Gpr6	G-protein coupled receptor 6	Q6YNI2
MOUSE		Gpr6	Gpr6 protein	Q2M2N8
RAT	83683	Gpr6	G-protein coupled receptor 6	P51651

Protein Classes

PANTHER Classes
protein / receptor / G-protein coupled receptor / G-protein coupled receptor 6

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / G-protein coupled receptor 6

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx