GPR6

DescriptionG-protein coupled receptor 6

Gene and Protein Information

Gene ID2830
Uniprot Accession IDs B4DHS9 J3KQR3 Q17RJ7 Q5SYL0
Ensembl ID ENSP00000406986
FamilyBelongs to the G-protein coupled receptor 1 family.
Sequence
MNASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGANGSLELSSQLSAGPPGLLLPAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYLVPSETVSLLTVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLAERAACSVVRPLARSHVALLSAAFFMVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSHEDPAVYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp104001079GPR6G protein-coupled receptor 69598VGNC:11087OMA, EggNOG
Macaque697979GPR6G protein-coupled receptor 69544Inparanoid, OMA, EggNOG
Mouse140741Gpr6G protein-coupled receptor 610090MGI:2155249Inparanoid, OMA, EggNOG
Rat83683Gpr6G protein-coupled receptor 610116RGD:70939Inparanoid, OMA, EggNOG
Dog481959GPR6G protein-coupled receptor 69615VGNC:41439Inparanoid, OMA, EggNOG
Cow506661GPR6G protein-coupled receptor 69913VGNC:29592Inparanoid, OMA, EggNOG
Pig100511485GPR6G protein-coupled receptor 69823OMA, EggNOG
Opossum100022066GPR6G protein-coupled receptor 613616Inparanoid, OMA, EggNOG
Chicken101747493GPR6G protein-coupled receptor 69031CGNC:72019Inparanoid, OMA
Anole lizard100563711gpr6G protein-coupled receptor 628377Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    receptor    /    G-protein coupled receptor    /    G-protein coupled receptor 6
DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    G-protein coupled receptor 6

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelActivityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityspeciesApplicationView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDisease TypeMondoid

      Pathway

      Data SourceNameExplore more targetsExplore in Source