SLC5A4
Description | Solute carrier family 5 member 4 |
---|
Gene and Protein Information
Gene ID | 6527 |
---|---|
Uniprot Accession IDs | O15279 |
Ensembl ID | ENSP00000266086 |
Symbol | SAAT1 SGLT3 SAAT1 SGLT3 DJ90G24.4 |
Family | Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
Sequence | MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA Show more |
Homologous gene and protein info.
Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
---|---|---|---|---|---|---|
Chimp | 470189 | SLC5A4 | solute carrier family 5 member 4 | 9598 | VGNC:7805 | OMA, EggNOG |
Macaque | 717137 | SLC5A4 | solute carrier family 5 member 4 | 9544 | Inparanoid, OMA, EggNOG | |
Mouse | 64452 | Slc5a4a | solute carrier family 5, member 4a | 10090 | MGI:1927848 | Inparanoid, OMA |
Rat | 294341 | Slc5a4 | solute carrier family 5 member 4 | 10116 | RGD:1306923 | Inparanoid, OMA |
Dog | 100685907 | SLC5A4 | solute carrier family 5 member 4 | 9615 | VGNC:46447 | Inparanoid, OMA, EggNOG |
Horse | 100058200 | SLC5A4 | solute carrier family 5 member 4 | 9796 | VGNC:52440 | Inparanoid, OMA |
Cow | 527441 | SLC5A4 | solute carrier family 5 member 4 | 9913 | VGNC:34907 | Inparanoid, OMA, EggNOG |
Pig | 397376 | SLC5A4 | solute carrier family 5 member 4 | 9823 | Inparanoid, OMA, EggNOG | |
Opossum | 100028976 | LOC100028976 | low affinity sodium-glucose cotransporter-like | 13616 | OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|