Protein or Target Summary
Solute carrier family 5 member 4
| Gene ID | 6527 |
|---|---|
| uniprot | Q9NY91 |
| Gene Name | SLC5A4 |
| Ensernbl ID | ENSP00000266086 |
| Family | Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family. |
| Sequence | MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAVGLWAMLKTNRGTIGGFFLAGRDMAWWPMGASLFASNIGSNHYVGLAGTGAASGVATVTFEWTSSVMLLILGWIFVPIYIKSGVMTMPEYLKKRFGGERLQVYLSILSLFICVVLLISADIFAGAIFIKLALGLDLYLAIFILLAMTAVYTTTGGLASVIYTDTLQTIIMLIGSFILMGFAFNEVGGYESFTEKYVNATPSVVEGDNLTISASCYTPRADSFHIFRDAVTGDIPWPGIIFGMPITALWYWCTNQVIVQRCLCGKDMSHVKAACIMCAYLKLLPMFLMVMPGMISRILYTDMVACVVPSECVKHCGVDVGCTNYAYPTMVLELMPQGLRGLMLSVMLASLMSSLTSIFNSASTLFTIDLYTKMRKQASEKELLIAGRIFVLLLTVVSIVWVPLVQVSQNGQLIHYTESISSYLGPPIAAVFVLAIFCKRVNEQGAFWGLMVGLAMGLIRMITEFAYGTGSCLAPSNCPKIICGVHYLYFSIVLFFGSMLVTLGISLLTKPIPDVHLYRLCWVLRNSTEERIDIDAEEKSQEETDDGVEEDYPEKSRGCLKKAYDLFCGLQKGPKLTKEEEEALSKKLTDTSERPSWRTIVNINAILLLAVVVFIHGYYA Show more |
Gene and Protein Information
Protein Classes
PANTHER Classes
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
protein / transporter / carbohydrate transporter / Solute carrier family 5 member 4
protein / transporter / cation transporter / Solute carrier family 5 member 4
DTO Classes
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
protein / Transporter / SLC superfamily of solute carriers / SLC5 family of sodium-dependent glucose transporters / Hexose transporter family / Solute carrier family 5 member 4
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx