JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

SCTR

Description	Secretin receptor

Gene and Protein Information

Gene ID	6344
Uniprot Accession IDs	Q12961 Q13213 Q53T00 SCT-R
Ensembl ID	ENSP00000019103
Symbol	SR
Family	Belongs to the G-protein coupled receptor 2 family.
Sequence	MRPHLSPPLQQLLLPVLLACAAHSTGALPRLCDVLQVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKLKVMYTVGYSSSLVMLLVALGILCAFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDVTYCDAHRAGCKLVMVLFQYCIMANYSWLLVEGLYLHTLLAISFFSERKYLQGFVAFGWGSPAIFVALWAIARHFLEDVGCWDINANASIWWIIRGPVILSILINFILFINILRILMRKLRTQETRGNEVSHYKRLARSTLLLIPLFGIHYIVFAFSPEDAMEIQLFFELALGSFQGLVVAVLYCFLNGEVQLEVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	459576	SCTR	secretin receptor	9598	VGNC:2810	OMA, EggNOG
Macaque	695182	SCTR	secretin receptor	9544		Inparanoid, OMA, EggNOG
Mouse	319229	Sctr	secretin receptor	10090	MGI:2441720	Inparanoid, OMA, EggNOG
Rat	81779	Sctr	secretin receptor	10116	RGD:621342	Inparanoid, OMA, EggNOG
Dog	483883	SCTR	secretin receptor	9615	VGNC:45934	Inparanoid, OMA, EggNOG
Horse	100051620	SCTR	secretin receptor	9796	VGNC:51491	Inparanoid, OMA, EggNOG
Cow	523291	SCTR	secretin receptor	9913	VGNC:34370	Inparanoid, OMA, EggNOG
Pig	100521045	SCTR	secretin receptor	9823		Inparanoid, EggNOG
Opossum	100013364	SCTR	secretin receptor	13616		Inparanoid, OMA, EggNOG
Chicken	770943	SCTR	secretin receptor	9031	CGNC:9179	Inparanoid, OMA, EggNOG

DTO Classes
protein / G-protein coupled receptor / Class B secretin like / Glucagon receptor / Secretin receptor

Name	Specification and purity	Expression system	Protein label	Availability	View Details

Name	Specifications	Species reactivity	Application	Availability	View Details

Name	Direct Associated Targets	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source