Protein or Target Summary
Probable G-protein coupled receptor 88
| Gene ID | 54112 |
|---|---|
| uniprot | Q9GZN0 |
| Gene Name | GPR88 |
| Ensernbl ID | ENSP00000314223 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 54112 | GPR88 | Probable G-protein coupled receptor 88 | Q9GZN0 |
| MOUSE | 64378 | Gpr88 | Probable G-protein coupled receptor 88 | Q9EPB7 |
| MOUSE | Gpr88 | Probable G-protein-coupled receptor 88 | A0A0G2JGJ3 | |
| MOUSE | 64378 | Gpr88 | G-protein coupled receptor 88 | B2RXU4 |
| RAT | 64443 | Gpr88 | Probable G-protein coupled receptor 88 | Q9ESP4 |
Protein Classes
PANTHER Classes
protein / receptor / G-protein coupled receptor / Probable g-protein coupled receptor 88
protein / receptor / G-protein coupled receptor / Probable g-protein coupled receptor 88
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Probable g-protein coupled receptor 88
protein / G-protein coupled receptor / Class A rhodopsin like / Probable g-protein coupled receptor 88
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx