Protein or Target Summary
Phospholipid hydroperoxide glutathione peroxidase
| Gene ID | 2879 |
|---|---|
| uniprot | P36969 |
| Gene Name | GPX4 |
| Ensernbl ID | ENSP00000346103 |
| Family | Belongs to the glutathione peroxidase family. |
| Sequence | MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 2879 | GPX4 | Phospholipid hydroperoxide glutathione peroxidase | P36969 |
| MOUSE | 625249 | Gpx4 | Phospholipid hydroperoxide glutathione peroxidase | O70325 |
| MOUSE | Gpx4 | Uncharacterized protein | Q3TIF2 | |
| MOUSE | 625249 | Gpx4 | Glutathione peroxidase | Q76LV0 |
| MOUSE | Gpx4 | Glutathione peroxidase | S4R1E5 | |
| MOUSE | Gpx4 | Glutathione peroxidase | Q5XJZ8 | |
| MOUSE | Gpx4 | Glutathione peroxidase | Q3TI34 | |
| RAT | 29328 | Gpx4 | Phospholipid hydroperoxide glutathione peroxidase | P36970 |
| RAT | Gpx4 | Glutathione peroxidase | F8WFK6 | |
| RAT | Gpx4 | Glutathione peroxidase | A0A0G2K398 |
Protein Classes
PANTHER Classes
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / oxidoreductase / peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
DTO Classes
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
protein / Enzyme / Oxidoreductase / Peroxidase / Phospholipid hydroperoxide glutathione peroxidase, mitochondrial
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx