The store will not work correctly when cookies are disabled.
Protein or Target Summary
Sodium-dependent serotonin transporter
Gene ID | 6532 |
uniprot | P31645 |
Gene Name | SLC6A4 |
Ensernbl ID | ENSP00000261707 |
Family | Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A4 subfamily. |
Sequence | METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLPYTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIMAWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGATLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVTLTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRICWVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIITPGTFKERIIKSITPETPTEIPCGDIRLNAV Show more |
---|
Gene and Protein Information
Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
---|
HUMAN | 6532 | SLC6A4 | Sodium-dependent serotonin transporter | P31645 |
MOUSE | 15567 | Slc6a4 | Sodium-dependent serotonin transporter | Q60857 |
MOUSE | | Slc6a4 | Serotonin transporter | Q5UBE7 |
MOUSE | | Slc6a4 | Transporter | Q5NCR5 |
MOUSE | | Slc6a4 | Transporter | Q32MU4 |
RAT | 25553 | Slc6a4 | Sodium-dependent serotonin transporter | P31652 |
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|