The store will not work correctly when cookies are disabled.
Protein or Target Summary
Stromal cell-derived factor 1
| Gene ID | 6387 |
|---|
| uniprot | P48061 |
|---|
| Gene Name | CXCL12 |
|---|
| Ensernbl ID | ENSP00000379140 |
|---|
| Family | Belongs to the intercrine alpha (chemokine CxC) family. |
|---|
| Sequence | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM Show more |
|---|
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|
| HUMAN | 6387 | CXCL12 | Stromal cell-derived factor 1 | P48061 |
| MOUSE | 20315 | Cxcl12 | Stromal cell-derived factor 1 | H7BX38 |
| MOUSE | 20315 | Cxcl12 | Stromal cell-derived factor 1 | P40224 |
| RAT | 24772 | Cxcl12 | Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) | Q9QZD1 |
| RAT | 24772 | Cxcl12 | C-X-C motif chemokine ligand 12 | Q80YV8 |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
