Protein or Target Summary
Secretory carrier-associated membrane protein 5
| Gene ID | 192683 |
|---|---|
| uniprot | Q8TAC9 |
| Gene Name | SCAMP5 |
| Ensernbl ID | ENSP00000355387 |
| Family | Belongs to the SCAMP family. SCAMP5 subfamily. |
| Sequence | MAEKVNNFPPLPKFIPLKPCFYQDFEADIPPQHVSMTKRLYYLWMLNSVTLAVNLVGCLAWLIGGGGATNFGLAFLWLILFTPCSYVCWFRPIYKAFKTDSSFSFMAFFFTFMAQLVISIIQAVGIPGWGVCGWIATISFFGTNIGSAVVMLIPTVMFTVMAVFSFIALSMVHKFYRGSGGSFSKAQEEWTTGAWKNPHVQQAAQNAAMGAAQGAMNQPQTQYSATPNYTYSNEM Show more |
Gene and Protein Information
| Species | Gene ID | Gene Symbol | Gene Name | Uniprot |
|---|---|---|---|---|
| HUMAN | 192683 | SCAMP5 | Secretory carrier-associated membrane protein 5 | Q8TAC9 |
| MOUSE | Scamp5 | Secretory carrier-associated membrane protein | A0A1L1SVG3 | |
| MOUSE | Scamp5 | Secretory carrier-associated membrane protein 5 | A0A1L1STB8 | |
| MOUSE | Scamp5 | Secretory carrier-associated membrane protein | A0A1L1SRT6 | |
| MOUSE | 56807 | Scamp5 | Secretory carrier-associated membrane protein 5 | Q9JKD3 |
| RAT | 65171 | Scamp5 | Secretory carrier-associated membrane protein | A0A0G2K464 |
| RAT | 65171 | Scamp5 | Secretory carrier-associated membrane protein 5 | Q9JKE3 |
Protein Classes
PANTHER Classes
protein / transfer/carrier protein / Secretory carrier-associated membrane protein 5
protein / transferase / Secretory carrier-associated membrane protein 5
protein / transfer/carrier protein / Secretory carrier-associated membrane protein 5
protein / transferase / Secretory carrier-associated membrane protein 5
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Disease Type | Mondoid |
|---|
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
Source: DataSourcesLicenses.xlsx