The store will not work correctly when cookies are disabled.
TAS2R20
| Description | Taste receptor type 2 member 20 |
|---|
Gene and Protein Information
| Gene ID | 259295 |
|---|
| Uniprot Accession IDs | P59549 Q2HIZ4 Q496D8 Q645X9 |
|---|
| Ensembl ID | ENSP00000441624 |
|---|
| Symbol | TAS2R49 T2R20 T2R49 T2R56 TAS2R49 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQKISSADQIIAALAVSRVGLLWVILLHWYSTVLNPTSSNLKVIIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHHLKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEGNVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIYSLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAIYFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILIWGNKTLKQTFLSVLWQVTCWAKGQNQSTP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 493898 | TAS2R20 | taste 2 receptor member 20 | 9598 | VGNC:13478 | Inparanoid, OMA |
| Rat | 690448 | Tas2r120 | taste receptor, type 2, member 120 | 10116 | RGD:1596060 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
