JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

Home
Targets(Human)
TAS2R38

TAS2R38

Description	Taste receptor type 2 member 38

Gene and Protein Information

Gene ID	5726
Uniprot Accession IDs	A4D1U6 P59552 Q2M3E8 Q645W3 Q86UK3 T2R38
Ensembl ID	ENSP00000448219
Symbol	PTC PTC T2R38 T2R61 THIOT
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVNFWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTHFQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSKLIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVWCFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYLWSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLEAHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVMVCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLKVRADHKADSRTLC Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	493889	TAS2R38	taste 2 receptor member 38	9598	VGNC:8771	Inparanoid, OMA
Macaque	695549	TAS2R38	taste 2 receptor member 38	9544		Inparanoid, OMA
Mouse	387513	Tas2r138	taste receptor, type 2, member 138	10090	MGI:2681306	Inparanoid, OMA
Dog	100271737	TAS2R38	taste 2 receptor member 38	9615	VGNC:47117	Inparanoid, OMA
Horse	106783090	TAS2R38	taste 2 receptor member 38	9796	VGNC:23881	Inparanoid, OMA
Cow	787789	TAS2R38	taste 2 receptor member 38	9913	VGNC:35612	Inparanoid, OMA

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 38

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

🔙[Back to Target (Human)]