JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

TAS2R39

Description	Taste receptor type 2 member 39

Gene and Protein Information

Gene ID	259285
Uniprot Accession IDs	A4FUI7 Q3ZCN6 Q645W4 T2R39
Ensembl ID	ENSP00000405095
Symbol	T2R39 T2R57
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472612	TAS2R39	taste 2 receptor member 39	9598	VGNC:8772	OMA, EggNOG
Mouse	353148	Tas2r139	taste receptor, type 2, member 139	10090	MGI:2681308	Inparanoid, OMA, EggNOG
Rat	680188	Tas2r139	taste receptor, type 2, member 139	10116	RGD:1595436	Inparanoid, OMA, EggNOG
Dog	100271735	TAS2R39	taste 2 receptor member 39	9615	VGNC:47118	Inparanoid, OMA, EggNOG
Pig	100621890	TAS2R39	taste 2 receptor member 39	9823		OMA, EggNOG
Opossum	664681	T2R39	bitter taste receptor Modo-T2R39	13616		OMA, EggNOG

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 39

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source