The store will not work correctly when cookies are disabled.
TAS2R39
| Description | Taste receptor type 2 member 39 |
|---|
Gene and Protein Information
| Gene ID | 259285 |
|---|
| Uniprot Accession IDs | A4FUI7 Q3ZCN6 Q645W4 T2R39 |
|---|
| Ensembl ID | ENSP00000405095 |
|---|
| Symbol | T2R39 T2R57 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAVLLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLSVSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFLNFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPWLLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTYLSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTLHMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFIYLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRRAWKRLQLRLHLYPKEWTL Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472612 | TAS2R39 | taste 2 receptor member 39 | 9598 | VGNC:8772 | OMA, EggNOG |
| Mouse | 353148 | Tas2r139 | taste receptor, type 2, member 139 | 10090 | MGI:2681308 | Inparanoid, OMA, EggNOG |
| Rat | 680188 | Tas2r139 | taste receptor, type 2, member 139 | 10116 | RGD:1595436 | Inparanoid, OMA, EggNOG |
| Dog | 100271735 | TAS2R39 | taste 2 receptor member 39 | 9615 | VGNC:47118 | Inparanoid, OMA, EggNOG |
| Pig | 100621890 | TAS2R39 | taste 2 receptor member 39 | 9823 | | OMA, EggNOG |
| Opossum | 664681 | T2R39 | bitter taste receptor Modo-T2R39 | 13616 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
