JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

྾

TAS2R41

Description	Taste receptor type 2 member 41

Gene and Protein Information

Gene ID	259287
Uniprot Accession IDs	P59550 Q495I2 Q50KJ5 Q50KJ6 Q50KJ7 Q645W7 T2R41
Ensembl ID	ENSP00000386201
Symbol	T2R41 T2R59
Family	Belongs to the G-protein coupled receptor T2R family.
Sequence	MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA Show more

Homologous gene and protein info.

Species	Gene ID	Gene Symbol	Name	Tax ID	Other Gene ID	Sources
Chimp	472562	TAS2R41	taste 2 receptor member 41	9598	VGNC:8775	Inparanoid, OMA, EggNOG
Mouse	387353	Tas2r126	taste receptor, type 2, member 126	10090	MGI:2681273	Inparanoid, OMA, EggNOG
Rat	246219	Tas2r126	taste receptor, type 2, member 126	10116	RGD:727853	Inparanoid, OMA, EggNOG
Dog	482734	TAS2R41	taste 2 receptor member 41	9615	VGNC:49729	Inparanoid, OMA, EggNOG
Pig	100524003	TAS2R41	taste 2 receptor member 41	9823		OMA, EggNOG
Opossum	664677	T2R41	bitter taste receptor Modo-T2R41	13616		Inparanoid, OMA, EggNOG
Xenopus	100335065	t2r13	bitter taste receptor 13	8364		OMA, EggNOG

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Taste 2 receptor / Taste receptor type 2 member 41

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Name	Specifications	Species reactivity	species	Application	View Details

Name	Disease Type	Mondoid

Data Source	Name	Explore more targets	Explore in Source