The store will not work correctly when cookies are disabled.
TAS2R41
| Description | Taste receptor type 2 member 41 |
|---|
Gene and Protein Information
| Gene ID | 259287 |
|---|
| Uniprot Accession IDs | P59550 Q495I2 Q50KJ5 Q50KJ6 Q50KJ7 Q645W7 T2R41 |
|---|
| Ensembl ID | ENSP00000386201 |
|---|
| Symbol | T2R41 T2R59 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGRLLPLDMILISLGASRFCLQLVGTVHNFYYSAQKVEYSGGLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHSTFLWLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVYQEFLIRKFSGNMTYKWNTRIETYYFPSLKLVIWSIPFSVFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALKSLISFLILYALSFLSLIIDAAKFISMQNDFYWPWQIAVYLCISVHPFILIFSNLKLRSVFSQLLLLARGFWVA Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472562 | TAS2R41 | taste 2 receptor member 41 | 9598 | VGNC:8775 | Inparanoid, OMA, EggNOG |
| Mouse | 387353 | Tas2r126 | taste receptor, type 2, member 126 | 10090 | MGI:2681273 | Inparanoid, OMA, EggNOG |
| Rat | 246219 | Tas2r126 | taste receptor, type 2, member 126 | 10116 | RGD:727853 | Inparanoid, OMA, EggNOG |
| Dog | 482734 | TAS2R41 | taste 2 receptor member 41 | 9615 | VGNC:49729 | Inparanoid, OMA, EggNOG |
| Pig | 100524003 | TAS2R41 | taste 2 receptor member 41 | 9823 | | OMA, EggNOG |
| Opossum | 664677 | T2R41 | bitter taste receptor Modo-T2R41 | 13616 | | Inparanoid, OMA, EggNOG |
| Xenopus | 100335065 | t2r13 | bitter taste receptor 13 | 8364 | | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
