The store will not work correctly when cookies are disabled.
TAS2R43
| Description | Taste receptor type 2 member 43 |
|---|
Gene and Protein Information
| Gene ID | 259289 |
|---|
| Uniprot Accession IDs | P59546 Q645X4 T2R43 |
|---|
| Ensembl ID | ENSP00000431719 |
|---|
| Symbol | T2R43 T2R52 |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIEWFKRQKISFADQILTALAVSRVGLLWVLLLNWYSTVLNPAFNSVEVRTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLHLKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEGNMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVISFLLLCAIYFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVFWQMRYWVKGEKTSSP Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Mouse | 353165 | Tas2r136 | taste receptor, type 2, member 136 | 10090 | MGI:2681304 | OMA, EggNOG |
| Rat | 100310876 | Tas2r136 | taste receptor, type 2, member 136 | 10116 | RGD:2314262 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
