The store will not work correctly when cookies are disabled.
TAS2R45
| Description | Taste receptor type 2 member 45 |
|---|
Gene and Protein Information
| Gene ID | 259291 |
|---|
| Uniprot Accession IDs | T2R45 |
|---|
| Symbol | GPR59 GPR59 T2R45 ZG24P |
|---|
| Family | Belongs to the G-protein coupled receptor T2R family. |
|---|
| Sequence | MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQKISFADQIVTALAVSRVGLLWVLLLNWYSTVLNPAFCSVELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIFLRLKRRVKSVILVVLLGPLLFLACHLFVVNMNQIVWTKEYEGNMTWKIKLRRAMYLSDTTVTMLANLVPFTVTLISFLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISFFLLRAIYFVSVIISVWSFKNLENKPVFMFCQAIGFSCSSAHPFILIWGNKKLKQTYLSVLWQMRY |
|---|
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
