The store will not work correctly when cookies are disabled.
TAAR1
| Description | Trace amine-associated receptor 1 |
|---|
Gene and Protein Information
| Gene ID | 134864 |
|---|
| Uniprot Accession IDs | Q2M1W5 Q3MIH8 Q5VUQ1 TaR-1 |
|---|
| Ensembl ID | ENSP00000275216 |
|---|
| Symbol | TA1 TAR1 TRAR1 TA1 TAR1 TRAR1 |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 493908 | TAAR1 | trace amine associated receptor 1 | 9598 | VGNC:3718 | Inparanoid, OMA, EggNOG |
| Macaque | 708944 | TAAR1 | trace amine associated receptor 1 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 111174 | Taar1 | trace amine-associated receptor 1 | 10090 | MGI:2148258 | Inparanoid, OMA, EggNOG |
| Rat | 113914 | Taar1 | trace-amine-associated receptor 1 | 10116 | RGD:621621 | Inparanoid, OMA, EggNOG |
| Horse | 106780887 | TAAR1 | trace amine associated receptor 1 | 9796 | VGNC:23835 | Inparanoid, OMA, EggNOG |
| Cow | 104969593 | TAAR1 | trace amine associated receptor 1 | 9913 | VGNC:35553 | Inparanoid, OMA, EggNOG |
| Opossum | 100031266 | TAAR1 | trace amine associated receptor 1 | 13616 | | Inparanoid, OMA, EggNOG |
| Platypus | 100074894 | TAAR1 | trace amine associated receptor 1 | 9258 | | Inparanoid, OMA, EggNOG |
| Chicken | 768536 | TAAR1 | trace amine associated receptor 1 | 9031 | CGNC:10460 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100553388 | taar1 | trace amine associated receptor 1 | 28377 | | Inparanoid, OMA, EggNOG |
| Zebrafish | 794715 | taar1b | trace amine associated receptor 1b | 7955 | ZDB-GENE-041014-58 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
