JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.

Click Here for 5% Off Your First Aladdin Purchase!

྾

Protein or Target Summary

Trace amine-associated receptor 1

Gene ID	134864
uniprot	Q96RJ0
Gene Name	TAAR1
Ensernbl ID	ENSP00000275216
Family	Belongs to the G-protein coupled receptor 1 family.
Sequence	MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS Show more

Gene and Protein Information

Species	Gene ID	Gene Symbol	Gene Name	Uniprot
HUMAN	134864	TAAR1	Trace amine-associated receptor 1	Q96RJ0
MOUSE	111174	Taar1	Trace amine-associated receptor 1	Q923Y8
RAT	113914	Taar1	Trace amine-associated receptor 1	A0A0G2JSP2
RAT	113914	Taar1	Trace amine-associated receptor 1	Q923Y9

Protein Classes

DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 1

Associated Recombinant Proteins

Name	Specification and purity	Expression system	Protein label	Activity	View Details

Associated Antibodies

Name	Specifications	Species reactivity	species	Application	View Details

Associated Approved Drugs

Associated Active Ligands

Associated Diseases

Name	Disease Type	Mondoid

Pathway

Data Source	Name	Explore more targets	Explore in Source

Source: DataSourcesLicenses.xlsx