Protein or Target Summary
Trace amine-associated receptor 5
Gene ID | 9038 |
---|---|
uniprot | O14804 |
Gene Name | TAAR5 |
Ensernbl ID | ENSP00000258034 |
Family | Belongs to the G-protein coupled receptor 1 family. |
Sequence | MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE Show more |
Gene and Protein Information
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
protein / G-protein coupled receptor / Class A rhodopsin like / Trace amine-associated receptor 5
Associated Recombinant Proteins
Name | Specification and purity | Expression system | Protein label | Activity | View Details |
---|
Associated Antibodies
Name | Specifications | Species reactivity | species | Application | View Details |
---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
Name | Disease Type | Mondoid |
---|
Pathway
Data Source | Name | Explore more targets | Explore in Source |
---|
Source: DataSourcesLicenses.xlsx