The store will not work correctly when cookies are disabled.
TAAR5
| Description | Trace amine-associated receptor 5 |
|---|
Gene and Protein Information
| Gene ID | 9038 |
|---|
| Uniprot Accession IDs | D8KZS1 Q2M1V1 Q4VBL1 Q5VUQ3 Q6NTA8 TaR-5 |
|---|
| Ensembl ID | ENSP00000258034 |
|---|
| Symbol | PNR PNR |
|---|
| Family | Belongs to the G-protein coupled receptor 1 family. |
|---|
| Sequence | MRAVFIQGAEEHPAAFCYQVNGSCPRTVHTLGIQLVIYLACAAGMLIIVLGNVFVAFAVSYFKALHTPTNFLLLSLALADMFLGLLVLPLSTIRSVESCWFFGDFLCRLHTYLDTLFCLTSIFHLCFISIDRHCAICDPLLYPSKFTVRVALRYILAGWGVPAAYTSLFLYTDVVETRLSQWLEEMPCVGSCQLLLNKFWGWLNFPLFFVPCLIMISLYVKIFVVATRQAQQITTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITPPLVFDIFIWFAYFNSACNPIIYVFSYQWFRKALKLTLSQKVFSPQTRTVDLYQE Show more |
|---|
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|
| Chimp | 472128 | TAAR5 | trace amine associated receptor 5 | 9598 | VGNC:3719 | Inparanoid, OMA, EggNOG |
| Macaque | 709325 | TAAR5 | trace amine associated receptor 5 | 9544 | | Inparanoid, OMA, EggNOG |
| Mouse | 215854 | Taar5 | trace amine-associated receptor 5 | 10090 | MGI:2685073 | Inparanoid, OMA, EggNOG |
| Rat | 294123 | Taar5 | trace amine-associated receptor 5 | 10116 | RGD:1359185 | Inparanoid, OMA, EggNOG |
| Dog | 483989 | TAAR5 | trace amine associated receptor 5 | 9615 | VGNC:47059 | Inparanoid, OMA, EggNOG |
| Horse | 100073122 | TAAR5 | trace amine-associated receptor 5 | 9796 | | OMA, EggNOG |
| Horse | 100073108 | LOC100073108 | trace amine-associated receptor 5-like | 9796 | | Inparanoid, OMA |
| Cow | 509368 | TAAR5 | trace amine associated receptor 5 | 9913 | VGNC:35554 | Inparanoid, OMA, EggNOG |
| Pig | 100152802 | TAAR5 | trace amine associated receptor 5 | 9823 | | OMA, EggNOG |
| Opossum | 100031228 | TAAR5 | trace amine associated receptor 5 | 13616 | | Inparanoid, OMA, EggNOG |
| Chicken | 768558 | TAAR5 | trace amine associated receptor 5 | 9031 | CGNC:10461 | Inparanoid, OMA |
| Anole lizard | 100553785 | taar5 | trace amine associated receptor 5 | 28377 | | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Activity | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | species | Application | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Pathway
| Data Source | Name | Explore more targets | Explore in Source |
|---|
